General Information

  • ID:  hor007036
  • Uniprot ID:  P42854??28-174)
  • Protein name:  Regenerating islet-derived protein 3-gamma 16.5 kDa form
  • Gene name:  NA
  • Organism:  Rattus norvegicus
  • Family:  NA
  • Source:  Animal
  • Expression:  Expressed in injured skeletal muscles and sciatic nerve (at protein level). Expressed in the pancreas. Expression increases during the acute phase of pancreatitis.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Euarchontoglires; Glires (Rodents and rabbits); Rodentia; Myomorpha (mice and others); Muroidea; Muridae; Murinae; Rattus; Rattus norvegicus (Rat)
  • GO MF:  GO:0005615 extracellular space; GO:0030141 secretory granule
  • GO BP:  GO:0005179 hormone activity; GO:0070492 oligosaccharide binding; GO:0046872 metal ion binding; GO:0042834 peptidoglycan binding; GO:0038023 signaling receptor activity
  • GO CC:  GO:0006953 acute-phase response; GO:0043434 response to peptide hormone; GO:0032496 response to lipopolysaccharide; GO:0009617 response to bacterium; GO:0090303 positive regulation of wound healing; GO:0010838 positive regulation of keratinocyte proliferation; GO:2000972 positive regulation of detection of glucose; GO:0008284 positive regulation of cell population proliferation; GO:0045617 negative regulation of keratinocyte differentiation; GO:0106015 negative regulation of inflammatory response to wounding; GO:0050728 negative regulation of inflammatory response; GO:0002755 MyD88-dependent toll-like receptor signaling pathway; GO:0050830 defense response to Gram-positive bacterium; GO:0050829 defense response to Gram-negative bacterium; GO:0061844 antimicrobial humoral immune response mediated by antimicrobial peptide; GO:0009611 response to wounding; GO:0009609 response to symbiotic bacterium

Sequence Information

  • Sequence:  DAKEDVPTSRISCPKGSRAYGSYCYALFSVSKSWFDADLACQKRPSGHLVSVLSGSEASFVSSLIKSSGNSGQNVWIGLHDPTLGQEPNRGGWEWSNADVMNYFNWETNPSSVSGSHCGTLTRASGFLRWRENNCISELPYVCKFKA
  • Length:  147
  • Propeptide:  MLPRVALTTMSWMLLSSLMLLSQVQGEDAKEDVPTSRISCPKGSRAYGSYCYALFSVSKSWFDADLACQKRPSGHLVSVLSGSEASFVSSLIKSSGNSGQNVWIGLHDPTLGQEPNRGGWEWSNADVMNYFNWETNPSSVSGSHCGTLTRASGFLRWRENNCISELPYVCKFKA
  • Signal peptide:  MLPRVALTTMSWMLLSSLMLLSQVQG
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  NA
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  NA

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    NA

Physical Information

Mass: Formula:
Absent amino acids: Common amino acids:
pI: Basic residues:
Polar residues: Hydrophobic residues:
Hydrophobicity: Boman Index:
Half-Life: Half-Life Yeast:
Half-Life E.Coli: Aliphatic Index
Instability Index: Extinction Coefficient cystines:
Absorbance 280nm:

Literature

  • PubMed ID:  NA
  • Title:  NA